OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BANF2 (NM_001014977) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308893
Recombinant protein of human barrier to autointegration factor 2 (BANF2), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "BANF2 or NM_001014977"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208893 protein sequence
Red=Cloning site Green=Tags(s)

MDDMSPRLRAFLSEPIGEKDVCWVDGISHELAINLVTKGINKAYILLGQFLLMHKNEAEFQRWLICCFGA
TECEAQQTSHCLKEWCACFL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 10.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001014977
Locus ID 140836
UniProt ID Q9H503
Cytogenetics 20p12.1
RefSeq Size 466
RefSeq ORF 270
Synonyms BAF-L; BAF2; BAFL; C20orf179
Summary May play a role in BANF1 regulation and influence tissue-specific roles of BANF1.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BANF2" proteins (7)
SKU Description Size Price
PH308893 BANF2 MS Standard C13 and N15-labeled recombinant protein (NP_001014977) 10 ug
$3,360.00
PH309388 BANF2 MS Standard C13 and N15-labeled recombinant protein (NP_848572) 10 ug
$3,360.00
LC405884 Lyophilized BANF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423098 Lyophilized BANF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405884 Transient overexpression lysate of barrier to autointegration factor 2 (BANF2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY423098 Transient overexpression lysate of barrier to autointegration factor 2 (BANF2), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP309388 Recombinant protein of human barrier to autointegration factor 2 (BANF2), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products