OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EIF4EBP2 (NM_004096) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308664
Recombinant protein of human eukaryotic translation initiation factor 4E binding protein 2 (EIF4EBP2), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349721 Rabbit Polyclonal Anti-EIF4EBP2 Antibody
100 ul
$205.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "EIF4EBP2 or NM_004096"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208664 protein sequence
Red=Cloning site Green=Tags(s)

MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQT
PPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 12.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004087
Locus ID 1979
UniProt ID Q13542
Cytogenetics 10q22.1
RefSeq Size 7531
RefSeq ORF 360
Synonyms 4EBP2; PHASII
Summary This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection. provided by RefSeq, Oct 2008
Protein Categories Growth Factors, Intracellular Proteins
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EIF4EBP2" proteins (4)
SKU Description Size Price
PH308664 EIF4EBP2 MS Standard C13 and N15-labeled recombinant protein (NP_004087) 10 ug
$3,360.00
LC418216 Lyophilized EIF4EBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418216 Transient overexpression lysate of eukaryotic translation initiation factor 4E binding protein 2 (EIF4EBP2) (as WB positive control) 100 ug
$436.00
TP720559 Recombinant protein of human eukaryotic translation initiation factor 4E binding protein 2 (EIF4EBP2) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products