OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LRATD1 (NM_145175) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308623
Recombinant protein of human family with sequence similarity 84, member A (FAM84A), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA372544 LRATD1 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "LRATD1 or NM_145175"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208623 protein sequence
Red=Cloning site Green=Tags(s)

MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSR
HHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQPAPEPPAP
APHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNSWYRYRPLVAELVVQNACGHLGLKSEEICWT
NSESFAAWCRFGKREFKAGGEVPAGTQPPQQQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRV
LQELADLVDDKE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Immunoprecipitation (PMID: 27325759)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_660158
Locus ID 151354
UniProt ID Q96KN4
Cytogenetics 2p24.3
RefSeq Size 6366
RefSeq ORF 876
Synonyms FAM84A; NSE1; PP11517
Summary May play a role in cell morphology and motility.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LRATD1" proteins (4)
SKU Description Size Price
PH308623 FAM84A MS Standard C13 and N15-labeled recombinant protein (NP_660158) 10 ug
$3,360.00
LC408037 Lyophilized FAM84A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408037 Transient overexpression lysate of family with sequence similarity 84, member A (FAM84A) (as WB positive control) 100 ug
$436.00
TP710355 Purified recombinant protein of human family with sequence similarity 84, member A (FAM84A), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$540.00

file-alt Citations

Distinct oligoclonal band antibodies in multiple sclerosis recognize ubiquitous self-proteins
Brändle, Obermeier, Senel et al
PNAS (2016)
Cited by 194
AI Summary: OriGene's commercial FAM84A protein preparation from HEK293 cells was used for immunoprecipitation experiments to identify autoantigen targets of oligoclonal band antibodies in multiple sclerosis patients.
Snippet: FAM84A (UniProt Q96KN4-1) is an intracellular protein of unknown function that is expressed in most tissues at very low levels of 0.2–2 RPKM. We used a commercial preparation (Origene) from HEK293 cells for immunoprecipitation
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products