LRATD1 (NM_145175) Human Recombinant Protein
CAT#: TP308623
Recombinant protein of human family with sequence similarity 84, member A (FAM84A), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208623 protein sequence
Red=Cloning site Green=Tags(s) MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSR HHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQPAPEPPAP APHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNSWYRYRPLVAELVVQNACGHLGLKSEEICWT NSESFAAWCRFGKREFKAGGEVPAGTQPPQQQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRV LQELADLVDDKE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | Immunoprecipitation (PMID: 27325759) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_660158 |
Locus ID | 151354 |
UniProt ID | Q96KN4 |
Cytogenetics | 2p24.3 |
Refseq Size | 6366 |
Refseq ORF | 876 |
Synonyms | FAM84A; NSE1; PP11517 |
Summary | May play a role in cell morphology and motility.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408037 | FAM84A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY408037 | Transient overexpression lysate of family with sequence similarity 84, member A (FAM84A) |
USD 436.00 |
|
PH308623 | FAM84A MS Standard C13 and N15-labeled recombinant protein (NP_660158) |
USD 3,255.00 |
|
TP710355 | Purified recombinant protein of human family with sequence similarity 84, member A (FAM84A), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 515.00 |
{0} Product Review(s)
Be the first one to submit a review