OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FUCA2 (NM_032020) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308566
Purified recombinant protein of Human fucosidase, alpha-L- 2, plasma (FUCA2),full length, with C-terminal MYC/DDK tag, expressed in HEK293 cells, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA370641 FUCA2 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "FUCA2 or NM_032020"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208566 representing NM_032020
Red=Cloning site Green=Tags(s)

MRPQELPRLAFPLLLLLLLLLPPPPCPAHSATRFDPTWESLDARQLPAWFDQAKFGIFIHWGVFSVPSFG
SEWFWWYWQKEKIPKYVEFMKDNYPPSFKYEDFGPLFTAKFFNANQWADIFQASGAKYIVLTSKHHEGFT
LWGSEYSWNWNAIDEGPKRDIVKELEVAIRNRTDLRFGLYYSLFEWFHPLFLEDESSSFHKRQFPVSKTL
PELYELVNNYQPEVLWSDGDGGAPDQYWNSTGFLAWLYNESPVRGTVVTNDRWGAGSICKHGGFYTCSDR
YNPGHLLPHKWENCMTIDKLSWGYRREAGISDYLTIEELVKQLVETVSCGGNLLMNIGPTLDGTISVVFE
ERLRQVGSWLKVNGEAIYETYTWRSQNDTVTPDVWYTSKPKEKLVYAIFLKWPTSGQLFLGHPKAILGAT
EVKLLGHGQPLNWISLEQNGIMVELPQLTIHQMPCKWGWALALTNVI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 53.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_114409
Locus ID 2519
UniProt ID Q9BTY2
Cytogenetics 6q24.2
RefSeq Size 2098
RefSeq ORF 1401
Synonyms dJ20N2.5
Summary This gene encodes a plasma alpha-L-fucosidase, which represents 10-20% of the total cellular fucosidase activity. The protein is a member of the glycosyl hydrolase 29 family, and catalyzes the hydrolysis of the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. This enzyme is essential for Helicobacter pylori adhesion to human gastric cancer cells. provided by RefSeq, Aug 2010
Protein Categories Intracellular Proteins, Secreated Proteins
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Other glycan degradation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FUCA2" proteins (2)
SKU Description Size Price
LC410345 Lyophilized FUCA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410345 Transient overexpression lysate of fucosidase, alpha-L- 2, plasma (FUCA2) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products