OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AMH (NM_000479) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308397
Recombinant protein of human anti-Mullerian hormone (AMH), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA600549 AMH Capture Rabbit Monoclonal antibody,clone OTIR5D9
100 ug
$458.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "AMH or NM_000479"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208397 representing NM_000479
Red=Cloning site Green=Tags(s)

MRDLPLTSLALVLSALGALLGTEALRAEEPAVGTSGLIFREDLDWPPGSPQEPLCLVALGGDSNGSSSPL
RVVGALSAYEQAFLGAVQRARWGPRDLATFGVCNTGDRQAALPSLRRLGAWLRDPGGQRLVVLHLEEVTW
EPTPSLRFQEPPPGGAGPPELALLVLYPGPGPEVTVTRAGLPGAQSLCPSRDTRYLVLAVDRPAGAWRGS
GLALTLQPRGEDSRLSTARLQALLFGDDHRCFTRMTPALLLLPRSEPAPLPAHGQLDTVPFPPPRPSAEL
EESPPSADPFLETLTRLVRALRVPPARASAPRLALDPDALAGFPQGLVNLSDPAALERLLDGEEPLLLLL
RPTAATTGDPAPLHDPTSAPWATALARRVAAELQAAAAELRSLPGLPPATAPLLARLLALCPGGPGGLGD
PLRALLLLKALQGLRVEWRGRDPRGPGRAQRSAGATAADGPCALRELSVDLRAERSVLIPETYQANNCQG
VCGWPQSDRNPRYGNHVVLLLKMQARGAALARPPCCVPTAYAGKLLISLSEERISAHHVPNMVATECGCR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 56.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity In vivo treatment (PMID: 29760445)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000470
Locus ID 268
UniProt ID P03971
Cytogenetics 19p13.3
RefSeq Size 2008
RefSeq ORF 1680
Synonyms MIF; MIS
Summary This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate N- and C-terminal cleavage products that homodimerize and associate to form a biologically active noncovalent complex. This complex binds to the anti-Mullerian hormone receptor type 2 and causes the regression of Mullerian ducts in the male embryo that would otherwise differentiate into the uterus and fallopian tubes. This protein also plays a role in Leydig cell differentiation and function and follicular development in adult females. Mutations in this gene result in persistent Mullerian duct syndrome. provided by RefSeq, Jul 2016
Protein Categories Growth Factors, Secreated Proteins
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Cytokine-cytokine receptor interaction, TGF-beta signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "AMH" proteins (5)
SKU Description Size Price
PH308397 AMH MS Standard C13 and N15-labeled recombinant protein (NP_000470) 10 ug
$3,360.00
LC424689 Lyophilized AMH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY424689 Transient overexpression lysate of anti-Mullerian hormone (AMH) (as WB positive control) 100 ug
$436.00
TP700250 Purified recombinant protein of secreted human anti-Mullerian hormone (AMH), with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$900.00
TP701045 Purified recombinant protein of Human anti-Mullerian hormone (AMH), with C-terminal His tag, secretory expressed in CHO cells, 20ug 20 ug
$900.00

file-alt Citations

Elevated prenatal anti-Müllerian hormone reprograms the fetus and induces polycystic ovary syndrome in adulthood
Tata, Mimouni, Barbotin et al
Nat. Med. (2018)
AI Summary: OriGene’s proAMH protein (cat. # TP308397) was used to treat pregnant mice and investigate the effects of elevated prenatal anti-Müllerian hormone on fetal development and the later onset of polycystic ovary syndrome-like symptoms.
Snippet: PAMH+GnRH antagtreated), (iv) 0.5mg kg−1 /d of cetrorelix acetate in PBS (prenatal GnRH antagtreated), and (v) PBS with 0.12mg kg−1 /d proAMH (Origene Technologies, cat. # TP308397;prenatal proAMH-treated, PproAMH)
Anti-mullerian hormone is expressed by endometriosis tissues and induces cell cycle arrest and apoptosis in endometriosis cells
Signorile, Petraglia, Baldi
J. Exp. Clin. Cancer Res. (2014) 33 (1), 46 DOI: 10.1186/1756-9966-33-46
Cited by 36
AI Summary: OriGene's Purified recombinant protein of Homo sapiens AMH was used to treat endometrial stromal and epithelial cells, enabling the researchers to assess AMH's effects on cell cycle arrest and apoptosis in endometriosis cells.
Snippet: endometrial stromal and epithelial cells were treated with Recombinant Human Mullerian-Inhibiting Substance (rhMIS)/anti-Mullerian hormone (AMH) - E-Coli derived (R&D Systems) and Purified recombinant protein of Homo sapiens AMH (OriGene Technologies, ... Cite SaveSaving
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products