OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

OLAH (NM_001039702) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308251
Recombinant protein of human oleoyl-ACP hydrolase (OLAH), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA335986 Rabbit Polyclonal Anti-OLAH Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "OLAH or NM_001039702"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208251 protein sequence
Red=Cloning site Green=Tags(s)

MERGDQPKRTRNENIFNCLYKNPEATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEP
LENDISQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHR
IPKDDELSEEQISHYLMEFGGTPKHFAEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGS
EDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLDPANEKLIKNYIIKCLEVSSISNF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 29.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001034791
Locus ID 55301
UniProt ID Q9NV23
Cytogenetics 10p13
RefSeq Size 1675
RefSeq ORF 795
Synonyms AURA1; SAST; TE2; THEDC1
Summary Contributes to the release of free fatty acids from fatty acid synthase (FASN). Has broad substrate specificity, giving rise to a range of free fatty acids with chain lengths between 10 and 16 carbon atoms (C10 - C16).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Protein Pathways Fatty acid biosynthesis, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "OLAH" proteins (5)
SKU Description Size Price
PH308251 OLAH MS Standard C13 and N15-labeled recombinant protein (NP_001034791) 10 ug
$3,360.00
LC400421 Lyophilized OLAH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413121 Lyophilized OLAH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400421 Transient overexpression lysate of oleoyl-ACP hydrolase (OLAH), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY413121 Transient overexpression lysate of oleoyl-ACP hydrolase (OLAH), transcript variant 1 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products