OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCDC78 (NM_001031737) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308165
Recombinant protein of human coiled-coil domain containing 78 (CCDC78), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA337790 Rabbit Polyclonal Anti-CCDC78 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CCDC78 or NM_001031737"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208165 protein sequence
Red=Cloning site Green=Tags(s)

MEHAATTGPRPGPPSRRVENVVLRAKDWLPGAPGGTAVWATSLEAEVPPDLALNKEQQLQISKELVDIQI
TTHHLHEQHEAEIFQLKSEILRLESRVLELELRGDGTSQGCAVPVESDPRHPRAAAQELRHKAQVPGHSD
DHRFQVQPKNTMNPENEQHRLGSGLQGEVKWALEHQEARQQALVTRVATLGRQLQGAREEARAAGQRLAT
QAVVLCSCQGQLRQAEAENARLQLQLKKLKDEYVLRLQHCARQAVEHADGAGQAPATTALRTFLEATLED
IRAAHRSREQQLARAARSYHKRLVDLSRRHEELLVAYRAPGNPQAIFDIASLDLEPLPVPLVTDFSHRED
QHGGPGALLSSPKKRPGGASQGGTSEPQGLDAASWAQIHQKLRDFSRSTQSWNGSGHSCWSGPRWLKSNF
LSYRSTWTSTWAGTSTKS

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 48.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001026907
Locus ID 124093
UniProt ID A2IDD5
Cytogenetics 16p13.3
RefSeq Size 1611
RefSeq ORF 1314
Synonyms C16orf25; CNM4; hsCCDC78; JFP10
Summary The product of this gene contains two coiled-coil domains. The function of this gene is currently unknown. provided by RefSeq, Sep 2012
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CCDC78" proteins (5)
SKU Description Size Price
PH308165 CCDC78 MS Standard C13 and N15-labeled recombinant protein (NP_001026907) 10 ug
$3,360.00
LC406609 Lyophilized CCDC78 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422182 Lyophilized CCDC78 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406609 Transient overexpression lysate of coiled-coil domain containing 78 (CCDC78), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422182 Transient overexpression lysate of coiled-coil domain containing 78 (CCDC78) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products