OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C13orf31 (LACC1) (NM_153218) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP307834
Recombinant protein of human chromosome 13 open reading frame 31 (C13orf31), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA337852 Rabbit Polyclonal Anti-LACC1 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "C13orf31 or NM_153218"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC207834 protein sequence
Red=Cloning site Green=Tags(s)

MAEAVLIDLFGLKLNSQKNCHQTLLKTLNAVQYHHAAKAKFLCIMCCSNISYERDGEQDNCEIETSNGLS
ALLEEFEIVSCPSMAATLYTIKQKIDEKNLSSIKVIVPRHRKTLMKAFIDQLFTDVYNFEFEDLQVTFRG
GLFKQSIEINVITAQELRGIQNEIETFLRSLPALRGKLTIITSSLIPDIFIHGFTTRTGGISYIPTLSSF
NLFSSSKRRDPKVVVQENLRRLANAAGFNVEKFYRIKTHHSNDIWIMGRKEPDSYDGITTNQRGVTIAAL
GADCIPIVFADPVKKACGVAHAGWKGTLLGVAMATVNAMIAEYGCSLEDIVVVLGPSVGPCCFTLPRESA
EAFHNLHPACVQLFDSPNPCIDIRKATRILLEQGGILPQNIQDQNQDLNLCTSCHPDKFFSHVRDGLNFG
TQIGFISIKE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 47.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Enzyme activity (PMID: 27959965)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_694950
Locus ID 144811
UniProt ID Q8IV20
Cytogenetics 13q14.11
RefSeq Size 4124
RefSeq ORF 1290
Synonyms C13orf31; FAMIN; JUVAR
Summary This gene encodes an oxidoreductase that promotes fatty-acid oxidation, with concomitant inflammasome activation, mitochondrial and NADPH-oxidase-dependent reactive oxygen species production, and bactericidal activity of macrophages. The encoded protein forms a complex with fatty acid synthase on peroxisomes and is thought to be modulated by peroxisome proliferator-activated receptor signaling events. Naturally occurring mutations in this gene are associated with inflammatory bowel disease, Behcet's disease, leprosy, ulcerative colitis, early-onset Crohn's disease, and systemic juvenile idiopathic arthritis. provided by RefSeq, Apr 2017
Protein Categories Allergies and autoimmune diseases, Cytokines, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C13orf31" proteins (7)
SKU Description Size Price
PH307834 C13orf31 MS Standard C13 and N15-labeled recombinant protein (NP_694950) 10 ug
$3,360.00
PH325705 C13orf31 MS Standard C13 and N15-labeled recombinant protein (NP_001121775) 10 ug
$3,360.00
LC407147 Lyophilized LACC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426942 Lyophilized LACC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407147 Transient overexpression lysate of chromosome 13 open reading frame 31 (C13orf31), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY426942 Transient overexpression lysate of chromosome 13 open reading frame 31 (C13orf31), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP325705 Recombinant protein of human chromosome 13 open reading frame 31 (C13orf31), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

Functional Analyses of the Crohn's Disease Risk Gene LACC1
Assadi, Vesterlund, Bonfiglio et al
PLoS ONE (2016) 11 (12), e0168276 DOI: 10.1371/journal.pone.0168276
AI Summary: OriGene’s recombinant FAMIN protein (C-terminal MYC/DDK tagged; TP307834) was used to assess laccase enzymatic activity in studies investigating the functional role of the Crohn’s disease risk gene LACC1.
Snippet: FAMIN laccase enzymatic activity was measured with recombinant FAMIN purified protein (C-terminal MYC/DDK tagged;OriGene, TP307834) using a standard spectrophotometric laccase assay and different oxidation substrates (Sigma-Aldrich) 2,6-dimethoxyphenol (DMP;D135550), guaiacol (G5502), L-DOPA (D9628) and syringaldazine (SGZ;S7896)
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products