OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MX1 (NM_002462) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP307418
Recombinant protein of human myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse) (MX1), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA500357 MX1 mouse monoclonal antibody, clone OTI2G12 (formerly 2G12) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "MX1 or NM_002462"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC207418 representing NM_002462
Red=Cloning site Green=Tags(s)

MVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLIDSLRALGVEQDLAL
PAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVE
KEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKTLIKKYIQRQE
TISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKC
RGQQEIQDQLSLSEALQREKIFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLLENQIKETH
QRITEELQKYGVDIPEDENEKMFFLIDKINAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIEN
NFQEGHKILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMVRLAFTDVSIK
NFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRGALQKVREKELEEEKKKKSWD
FGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMLQLLQDKDTYSWLL
KERSDTSDKRKFLKERLARLTQARRRLAQFPG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 75.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002453
Locus ID 4599
UniProt ID P20591
Cytogenetics 21q22.3
RefSeq Size 2787
RefSeq ORF 1986
Synonyms IFI-78K; IFI78; lncMX1-215; MX; MxA
Summary This gene encodes a guanosine triphosphate (GTP)-metabolizing protein that participates in the cellular antiviral response. The encoded protein is induced by type I and type II interferons and antagonizes the replication process of several different RNA and DNA viruses. There is a related gene located adjacent to this gene on chromosome 21, and there are multiple pseudogenes located in a cluster on chromosome 4. Alternative splicing results in multiple transcript variants. provided by RefSeq, Sep 2013
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MX1" proteins (7)
SKU Description Size Price
PH307418 MX1 MS Standard C13 and N15-labeled recombinant protein (NP_002453) 10 ug
$3,360.00
PH327878 MX1 MS Standard C13 and N15-labeled recombinant protein (NP_001138397) 10 ug
$3,360.00
LC400886 Lyophilized MX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428580 Lyophilized MX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400886 Transient overexpression lysate of myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse) (MX1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428580 Transient overexpression lysate of myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse) (MX1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP327878 Recombinant protein of human myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse) (MX1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

RABGAP1 acts as a sensor to facilitate sorting and processing of amyloid precursor protein
Eden, Kaufman, Cattin-Ortola et al
bioRxiv (2024)
Cited by 1
Snippet: For RABGAP1 KD in primary neurons, lentivirus containing RABGAP1 shRNAs was added to the neurons on DIV5. Lentiviral GFP vectors containing 29mer shRNAs targeting rat RABGAP1 were obtained from Origene (TL706390). The RABGAP1 shRNA sequence (5’-3’) used was: GAACA GGCAT TCAGT GTTCT GGTCA AGAT
cGAS suppresses hepatocellular carcinoma independent of its cGAMP synthase activity
Ma, Yang, Sun et al
Cell Death Differ (2024)
Cited by 13
AI Summary: OriGene’s MX1 cytokine (TP307418) was used in this study to investigate the molecular mechanisms underlying cGAS-mediated suppression of hepatocellular carcinoma.
Snippet: tamine2000 (11668) was from Invitrogen, cGAMP (tlrl-cga23) was from InvivoGen (USA), CXCL10 (300-12), IFNβ (300-02BC) cytokines were from Peprotech (USA) and MX1 (TP307418) cytokines were from OriGene (USA). Sorafenib (S7397) was from Selleck (USA), anti-FLAG M2 Affinity agarose (A2220) wa
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products