OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TIRAP (NM_001039661) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP307162
Recombinant protein of human toll-interleukin 1 receptor (TIR) domain containing adaptor protein (TIRAP), transcript variant 3, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA306133 Rabbit Polyclonal TIRAP Antibody
100 ug
$640.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "TIRAP or NM_001039661"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC207162 protein sequence
Red=Cloning site Green=Tags(s)

MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLP
PTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSS
HCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVK
EAVMRYLQTLSWHLLYHGTPEIGVKLETENPCRASDSHKCDKRYRE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 23.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001034750
Locus ID 114609
UniProt ID P58753
Cytogenetics 11q24.2
RefSeq Size 2348
RefSeq ORF 768
Synonyms BACTS1; Mal; MyD88-2; wyatt
Summary The innate immune system recognizes microbial pathogens through Toll-like receptors (TLRs), which identify pathogen-associated molecular patterns. Different TLRs recognize different pathogen-associated molecular patterns and all TLRs have a Toll-interleukin 1 receptor (TIR) domain, which is responsible for signal transduction. The protein encoded by this gene is a TIR adaptor protein involved in the TLR4 signaling pathway of the immune system. It activates NF-kappa-B, MAPK1, MAPK3 and JNK, which then results in cytokine secretion and the inflammatory response. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described. provided by RefSeq, Jul 2008
Protein Categories Chemokines, Cytokines, Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways Toll-like receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TIRAP" proteins (3)
SKU Description Size Price
PH307162 TIRAP MS Standard C13 and N15-labeled recombinant protein (NP_001034750) 10 ug
$3,360.00
LC422104 Lyophilized TIRAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422104 Transient overexpression lysate of toll-interleukin 1 receptor (TIR) domain containing adaptor protein (TIRAP), transcript variant 3 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products