OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C12orf26 (METTL25) (NM_032230) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP306658
Recombinant protein of human chromosome 12 open reading frame 26 (C12orf26), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA507335 C12orf26 (METTL25) mouse monoclonal antibody, clone OTI2B6 (formerly 2B6) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "C12orf26 or NM_032230"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206658 protein sequence
Red=Cloning site Green=Tags(s)

MAASCPLPVTPDLPTLRAKLQGLLQFLRDALSISNAHTVDFYTESVWEELVDLPPETVLAALRKSASETE
ALPSETRPLVEAEWEAGMTDFPKIFCETSQKLVSVEAFALAAKYYSVQNLGICTPFEQLLVALRGNQNQR
IGENQKAVEFMNMKKSHEVQAMSELISSIADYYGIKQVIDLGSGKGYLSSFLSLKYGLKVYGIDSSNTNT
HGAEERNRKLKKHWKLCHAQSRLDVNGLALKMAKERKVKNKVKNKADTEEVFNNSPTNQEKMPTSAILPD
FSGSVISNIRNQMETLHSQPHQEENLCFENSFSLINLLPINAVEPTSSQQIPNRETSEANKERRKMTSKS
SESNIYSPLTSFITADSELHDIIKDLEDCLMVGLHTCGDLAPNTLRIFTSNSEIKGVCSVGCCYHLLSEE
FENQHKERTQEKWGFPMCHYLKEERWCCGRNARMSACLALERVAAGQGLPTESLFYRAVLQDIIKDCYGI
TKCDRHVGKIYSKCSSFLDYVRRSLKKLGLDESKLPEKIIMNYYEKYKPRMNELEAFNMLKVVLAPCIET
LILLDRLCYLKEQEDIAWSALVKLFDPVKSPRCYAVIALKKQQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 68 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_115606
Locus ID 84190
UniProt ID Q8N6Q8
Cytogenetics 12q21.31
RefSeq Size 2105
RefSeq ORF 1809
Synonyms C12orf26
Summary Putative methyltransferase.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C12orf26" proteins (3)
SKU Description Size Price
PH306658 C12orf26 MS Standard C13 and N15-labeled recombinant protein (NP_115606) 10 ug
$3,360.00
LC410257 Lyophilized METTL25 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410257 Transient overexpression lysate of chromosome 12 open reading frame 26 (C12orf26) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products