OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Meis homeobox 3 (MEIS3) (NM_020160) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP306100
Recombinant protein of human Meis homeobox 3 (MEIS3), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA800268 MEIS3 (Meis homeobox 3) mouse monoclonal antibody, clone OTI3E12 (formerly 3E12) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Meis homeobox 3 or NM_020160"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206100 protein sequence
Red=Cloning site Green=Tags(s)

MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLA
LVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVL
RFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDS
GSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAW
LFQHLSRRSEAPVLPDVCLGLGSPSPGPRWARPWGSDCGRPGRQSDSCWWLQHPYPSEEQKKQLAQDTGL
TILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHY
L

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 46 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_064545
Locus ID 56917
UniProt ID Q99687
Cytogenetics 19q13.32
RefSeq Size 2166
RefSeq ORF 1263
Synonyms MRG2
Summary This gene encodes a homeobox protein and probable transcriptional regulator. The orthologous protein in mouse controls expression of 3-phosphoinositide dependent protein kinase 1, which promotes survival of pancreatic beta-cells. provided by RefSeq, Sep 2016
Protein Categories Intracellular Proteins, Transciption Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Meis homeobox 3" proteins (7)
SKU Description Size Price
PH306100 MEIS3 MS Standard C13 and N15-labeled recombinant protein (NP_064545) 10 ug
$3,360.00
PH309662 MEIS3 MS Standard C13 and N15-labeled recombinant protein (NP_001009813) 10 ug
$3,360.00
LC412624 Lyophilized MEIS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422933 Lyophilized MEIS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412624 Transient overexpression lysate of Meis homeobox 3 (MEIS3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422933 Transient overexpression lysate of Meis homeobox 3 (MEIS3), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP309662 Recombinant protein of human Meis homeobox 3 (MEIS3), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products