OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Proteasome subunit beta type 4 (PSMB4) (NM_002796) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP305723
Recombinant protein of human proteasome (prosome, macropain) subunit, beta type, 4 (PSMB4), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA503558 PSMB4 (Proteasome subunit beta type 4 ) mouse monoclonal antibody, clone OTI2C9 (formerly 2C9) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Proteasome subunit beta type 4 or NM_002796"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205723 representing NM_002796
Red=Cloning site Green=Tags(s)

MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAAD
MLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRA
MYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEA
RDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 29 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002787
Locus ID 5692
UniProt ID P28070
Cytogenetics 1q21.3
RefSeq Size 925
RefSeq ORF 792
Synonyms HN3; HsN3; PRAAS3; PROS-26; PROS26
Summary The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. provided by RefSeq, Jul 2008
Protein Categories Enzyme: Peptidases, Immune system diseases, Intracellular Proteins
Protein Families Druggable Genome, Protease
Protein Pathways Proteasome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Proteasome subunit beta type 4" proteins (3)
SKU Description Size Price
PH305723 PSMB4 MS Standard C13 and N15-labeled recombinant protein (NP_002787) 10 ug
$3,360.00
LC419106 Lyophilized PSMB4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419106 Transient overexpression lysate of proteasome (prosome, macropain) subunit, beta type, 4 (PSMB4) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products