OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CAMK2B (NM_172081) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP305669
Recombinant protein of human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 5, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA808345 CAMK2B mouse monoclonal antibody, clone OTI8D9 (formerly 8D9) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CAMK2B or NM_172081"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205669 protein sequence
Red=Cloning site Green=Tags(s)

MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICRLLKH
SNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPE
NLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKEAYGKPVDIWACGVILYILLVG
YPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVAS
MMHRQETVECLKKFNARRKLKGAILTTMLATRNFSAAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPP
AALESSDSANTTIEDEDAKARKQEIIKTTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFH
RFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNV
HFHCSGAPVAPLQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 56.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_742078
Locus ID 816
UniProt ID Q13554
Cytogenetics 7p13
RefSeq Size 4097
RefSeq ORF 1509
Synonyms CAM2; CAMK2; CAMKB; CaMKIIbeta; MRD54
Summary The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a beta chain. It is possible that distinct isoforms of this chain have different cellular localizations and interact differently with calmodulin. Alternative splicing results in multiple transcript variants. provided by RefSeq, May 2014
Protein Categories Enzyme: Kinases, Intracellular Proteins, Membrane Proteins
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Calcium signaling pathway, ErbB signaling pathway, Glioma, GnRH signaling pathway, Long-term potentiation, Melanogenesis, Neurotrophin signaling pathway, Olfactory transduction, Oocyte meiosis, Wnt signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CAMK2B" proteins (21)
SKU Description Size Price
PH305669 CAMK2B MS Standard C13 and N15-labeled recombinant protein (NP_742078) 10 ug
$3,360.00
LC406822 Lyophilized CAMK2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406823 Lyophilized CAMK2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406824 Lyophilized CAMK2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406825 Lyophilized CAMK2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406826 Lyophilized CAMK2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406827 Lyophilized CAMK2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406828 Lyophilized CAMK2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420062 Lyophilized CAMK2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406822 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY406823 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY406824 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 4 (as WB positive control) 100 ug
$665.00
LY406825 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY406826 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 6 (as WB positive control) 100 ug
$665.00
LY406827 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 7 (as WB positive control) 100 ug
$665.00
LY406828 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 8 (as WB positive control) 100 ug
$665.00
LY420062 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP720912 Purified recombinant protein of Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 5 10 ug
$330.00
TP762573 Purified recombinant protein of Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug 50 ug
$270.00
TP762608 Purified recombinant protein of Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug 50 ug
$270.00
TP762620 Purified recombinant protein of Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 6, full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products