OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SHCBP1 (NM_024745) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP305527
Recombinant protein of human SHC SH2-domain binding protein 1 (SHCBP1), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA371041 SHCBP1 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SHCBP1 or NM_024745"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205527 protein sequence
Red=Cloning site Green=Tags(s)

MADGSLTGGGLEAAAMAPERTGWAVEQELASLEKGLFQDEDSCSDCSYRDKPGSSLQSFMPEGKTFFPEI
FQTNQLLFYERFRAYQDYILADCKASEVQEFTAEFLEKVLEPSGWRAVWHTNVFKVLVEITDVDFAALKA
VVRLAEPYLCDSQVSTFTMECMKELLDLKEHRLPLQELWVVFDDSGVFDQTALAIEHVRFFYQNIWRSWD
EEEEDEYDYFVRCVEPRLRLHYDILEDRVPSGLIVDYHNLLSQCEESYRKFLNLRSSLSNCNSDSEQENI
SMVEGLKLYSEMEQLKQKLKLIENPLLRYVFGYQKNSNIQAKGVRSSGQKITHVVSSTMMAGLLRSLLTD
RLCQEPGEEEREIQFHSDPLSAINACFEGDTVIVCPGHYVVHGTFSIADSIELEGYGLPDDIVIEKRGKG
DTFVDCTGADIKISGIKFVQHDAVEGILIVHRGKTTLENCVLQCETTGVTVRTSAEFLMKNSDLYGAKGA
GIEIYPGSQCTLSDNGIHHCKEGILIKDFLDEHYDIPKISMVNNIIHNNEGYGVVLVKPTIFSDLQESAE
DGTEENKALKIQTSGEPDVAERVDLEELIECATGKMELCARTDPSEQVEGNCEIVNELIAASTQKGQIKK
KRLSELGITQADDNLMSQEMFVGIVGNQFKWNGKGSFGTFLF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 75.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_079021
Locus ID 79801
UniProt ID Q8NEM2
Cytogenetics 16q11.2
RefSeq Size 3249
RefSeq ORF 2016
Synonyms PAL
Summary May play a role in signaling pathways governing cellular proliferation, cell growth and differentiation. May be a component of a novel signaling pathway downstream of Shc. Acts as a positive regulator of FGF signaling in neural progenitor cells.UniProtKB/Swiss-Prot Function
Protein Categories Growth Factors, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SHCBP1" proteins (3)
SKU Description Size Price
PH305527 SHCBP1 MS Standard C13 and N15-labeled recombinant protein (NP_079021) 10 ug
$3,360.00
LC411097 Lyophilized SHCBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411097 Transient overexpression lysate of SHC SH2-domain binding protein 1 (SHCBP1) (as WB positive control) 100 ug
$436.00

file-alt Citations

Non-kinase Orchestrated VEGFR2-ERK Signaling is a Dependency and Pharmacological Target for Antiangiogenic Immunotherapy
Shi, Ma, Wang et al
Cancer Res (2026)
AI Summary: OriGene products, specifically recombinant SHCBP1 protein (#TP305527) and SHC protein (#TP304362), were used in this study to investigate the roles of non-kinase components in VEGFR2-ERK signaling and their impact on tumor angiogenesis and immunotherapy response.
Snippet: Recombinant SHCBP1 protein (#TP305527, Origene), SHC protein (#TP304362, Origene), 239 ERK protein (#M29–14U–20, Sino Biological, Beijing), VEGFR2 protein (#10012–H20B1, Sino 240 Biological, Beijing), SHC-PTB domain protein (produced in-house)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products