OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NEUROD2 (NM_006160) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP305293
Recombinant protein of human neurogenic differentiation 2 (NEUROD2), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA314246 Rabbit polyclonal anti-NDF2 antibody
100 ul
$380.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "NEUROD2 or NM_006160"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205293 protein sequence
Red=Cloning site Green=Tags(s)

MLTRLFSEPGLLSDVPKFASWGDGEDDEPRSDKGDAPPPPPPAPGPGAPGPARAAKPVPLRGEEGTEATL
AEVKEEGELGGEEEEEEEEEEGLDEAEGERPKKGGPKKRKMTKARLERSKLRRQKANARERNRMHDLNAA
LDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKRPDLVSYVQTLCKGLSQPTTNLVAGCLQL
NSRNFLTEQGADGAGRFHGSGGPFAMHPYPYPCSRLAGAQCQAAGGLGGGAAHALRTHGYCAAYETLYAA
AGGGGASPDYNSSEYEGPLSPPLCLNGNFSLKQDSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVR
GGVHSENLLSYDMHLHHDRGPMYEELNAFFHN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 41.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006151
Locus ID 4761
UniProt ID Q15784
Cytogenetics 17q12
RefSeq Size 3048
RefSeq ORF 1146
Synonyms bHLHa1; DEE72; EIEE72; NDRF
Summary This gene encodes a member of the neuroD family of neurogenic basic helix-loop-helix (bHLH) proteins. Expression of this gene can induce transcription from neuron-specific promoters, such as the GAP-43 promoter, which contain a specific DNA sequence known as an E-box. The product of the human gene can induce neurogenic differentiation in non-neuronal cells in Xenopus embryos, and is thought to play a role in the determination and maintenance of neuronal cell fates. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins, Nervous system Diseases, Transciption Factors
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NEUROD2" proteins (4)
SKU Description Size Price
PH305293 NEUROD2 MS Standard C13 and N15-labeled recombinant protein (NP_006151) 10 ug
$3,360.00
LC416831 Lyophilized NEUROD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416831 Transient overexpression lysate of neurogenic differentiation 2 (NEUROD2) (as WB positive control) 100 ug
$436.00
TP761758 Purified recombinant protein of Human neurogenic differentiation 2 (NEUROD2), full length, with N-terminal His tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products