OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GRO beta (CXCL2) (NM_002089) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP304877
Recombinant protein of human chemokine (C-X-C motif) ligand 2 (CXCL2), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "GRO beta or NM_002089"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204877 protein sequence
Red=Cloning site Green=Tags(s)

MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCA
QTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 11.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002080
Locus ID 2920
UniProt ID P19875
Cytogenetics 4q13.3
RefSeq Size 1234
RefSeq ORF 321
Synonyms CINC-2a; GRO2; GROb; MGSA-b; MIP-2a; MIP2; MIP2A; SCYB2
Summary This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CXC subfamily, is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. provided by RefSeq, Sep 2014
Protein Categories Chemokines, Cytokines, Secreated Proteins
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction, NOD-like receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GRO beta" proteins (3)
SKU Description Size Price
PH304877 CXCL2 MS Standard C13 and N15-labeled recombinant protein (NP_002080) 10 ug
$3,360.00
TP720606 Purified recombinant protein of Human chemokine (C-X-C motif) ligand 2 (CXCL2) 10 ug
$340.00
TP723792 Purified recombinant protein of Human chemokine (C-X-C motif) ligand 2 (CXCL2 / Grobeta) 10 ug
$440.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products