OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HLA (NM_182549) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP304511
Recombinant protein of human major histocompatibility complex, class II, DQ beta 2 (HLA-DQB2), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA366436 HLA-DQB2 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "HLA or NM_182549"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204511 representing NM_182549
Red=Cloning site Green=Tags(s)

MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIYNREEYG
RFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEAL
NHHNLLVCSVTDFYPAQIKVQWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGDIYTCQVEHPS
LQSPITVEWRPRGPPPAGLLH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 27
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_872355
Locus ID 3120
UniProt ID P05538
Cytogenetics 6p21.32
RefSeq Size 1092
RefSeq ORF 693
Synonyms HLA-DQB1; HLA-DXB
Summary HLA-DQB2 belongs to the family of HLA class II beta chain paralogs. Class II molecules are heterodimers consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. They play a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). Polymorphisms in the alpha and beta chains specify the peptide binding specificity, and typing for these polymorphisms is routinely done for bone marrow transplantation. However this gene, HLA-DQB2, is not routinely typed, as it is not thought to have an effect on transplantation. There is conflicting evidence in the literature and public sequence databases for the protein-coding capacity of HLA-DQB2. Because there is evidence of transcription and an intact ORF, HLA-DQB2 is represented in Entrez Gene and in RefSeq as a protein-coding locus. provided by RefSeq, Oct 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HLA" proteins (3)
SKU Description Size Price
PH304511 HLA MS Standard C13 and N15-labeled recombinant protein (NP_872355) 10 ug
$3,360.00
LC403637 Lyophilized HLA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403637 Transient overexpression lysate of major histocompatibility complex, class II, DQ beta 2 (HLA-DQB2) (as WB positive control) 100 ug
$436.00

file-alt Citations

Soluble factors derived from human amniotic epithelial cells suppress collagen production in human hepatic stellate cells
Hodge, Lourensz, Vaghjiani et al
Cytotherapy (2014)
Cited by 55
AI Summary: OriGene’s purified recombinant HLA-G1 protein was used to treat hepatic stellate cells, enabling the study to demonstrate that this specific soluble factor from hAECs significantly reduced collagen and TGF-β1 production, thus contributing to the investigation of anti-fibrotic mechanisms.
Snippet: Purified recombinant HLA-G1 protein (Origene, Rockville, MD, USA) was added to confluent HSCs grown in DMEM/F12 with FCS in concentrations of 25, 50 and 100 ng/mL, cultured for a further 48 h before the supernatant was removed and collagen synthesis in the ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products