OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RCL (DNPH1) (NM_006443) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303989
Recombinant protein of human chromosome 6 open reading frame 108 (C6orf108), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "RCL or NM_006443"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203989 protein sequence
Red=Cloning site Green=Tags(s)

MAAAMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHVAAAELGARGEEAA
GGDRLIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRF
QVWDYEEGEVEALLDRYFEADPPGQVAASPDPTT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 18.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006434
Locus ID 10591
UniProt ID O43598
Cytogenetics 6p21.1
RefSeq Size 662
RefSeq ORF 522
Synonyms C6orf108; dJ330M21.3; RCL
Summary This gene was identified on the basis of its stimulation by c-Myc protein. The latter is a transcription factor that participates in the regulation of cell proliferation, differentiation, and apoptosis. The exact function of this gene is not known but studies in rat suggest a role in cellular proliferation and c-Myc-mediated transformation. Two alternative transcripts encoding different proteins have been described. provided by RefSeq, Jul 2008
Protein Categories Growth Factors, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RCL" proteins (5)
SKU Description Size Price
PH303989 C6orf108 MS Standard C13 and N15-labeled recombinant protein (NP_006434) 10 ug
$3,360.00
LC404680 Lyophilized DNPH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416630 Lyophilized DNPH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404680 Transient overexpression lysate of chromosome 6 open reading frame 108 (C6orf108), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY416630 Transient overexpression lysate of chromosome 6 open reading frame 108 (C6orf108), transcript variant 1 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products