OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ABHD11 (NM_148912) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303904
Recombinant protein of human abhydrolase domain containing 11 (ABHD11), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA315870 Rabbit polyclonal anti-ABHD11 antibody
100 ul
$380.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "ABHD11 or NM_148912"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203904 protein sequence
Red=Cloning site Green=Tags(s)

MRAGQQLASMLRWTRAWRLPREGLGPHGPSFARVPVAPSSSSGGRGGAEPRPLPLSYRLLDGEAALPAVV
FLHGLFGSKTNFNSIAKILAQQTGRRVLTVDARNHGDSPHSPDMSYEIMSQDLQDLLPQLGLVPCVVVGH
SMGGKTAMLLALQRPELVERLIAVDISPVESTGVSHFATYVAAMRAINIADELPRSRARKLADEQLSSVI
QDMAVRQHLLTNLVEVDGRFVWRVNLDALTQHLDKILAFPQRQESYLGPTLFLLGGNSQFVHPSHHPEIM
RLFPRAQMQTVPNAGHWIHADRPQDFIAAIRGFLV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 34.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_683710
Locus ID 83451
UniProt ID Q8NFV4
Cytogenetics 7q11.23
RefSeq Size 1467
RefSeq ORF 945
Synonyms PP1226; WBSCR21
Summary This gene encodes a protein containing an alpha/beta hydrolase fold domain. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. provided by RefSeq, Mar 2016
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ABHD11" proteins (5)
SKU Description Size Price
PH303904 ABHD11 MS Standard C13 and N15-labeled recombinant protein (NP_683710) 10 ug
$3,360.00
LC407728 Lyophilized ABHD11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430200 Lyophilized ABHD11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407728 Transient overexpression lysate of abhydrolase domain containing 11 (ABHD11), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY430200 Transient overexpression lysate of abhydrolase domain containing 11 (ABHD11), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products