OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ALIX (PDCD6IP) (NM_013374) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303735L
Recombinant protein of human programmed cell death 6 interacting protein (PDCD6IP), 1 mg
Size:
1 mg 20 ug 100 ug
  $9,200.00
6 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA507312 PDCD6IP mouse monoclonal antibody, clone OTI1A4 (formerly 1A4) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "ALIX or NM_013374"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203735 protein sequence
Red=Cloning site Green=Tags(s)

MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLR
YYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNL
DNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKD
AIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHA
AELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQK
FTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTK
SRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRA
EGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVNVLKSLLSNLD
EVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQ
VSHQEFSKMKQSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKT
ERDELLKDLQQSIAREPSAPSIPTPAYQSSPAGGHAPTPPTPAPRTMPPTKPQPPARPPPPVLPANRAPS
ATAPSPVGAGTAAPAPSQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQS
PGQAPYPGPQQPSYPFPQPPQQSYYPQQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 95.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_037506
Locus ID 10015
UniProt ID Q8WUM4
Cytogenetics 3p22.3
RefSeq Size 5972
RefSeq ORF 2604
Synonyms AIP1; ALIX; DRIP4; HP95
Summary This gene encodes a protein that functions within the ESCRT pathway in the abscission stage of cytokinesis, in intralumenal endosomal vesicle formation, and in enveloped virus budding. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization, which may be partly responsible for the protection against cell death. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Related pseudogenes have been identified on chromosome 15. provided by RefSeq, Jan 2012
Protein Categories Cytokines, Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways Endocytosis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Coactivator Associated Arginine Methyltransferase 1 (CARM1) as a Contributor to Motoneuron Biology
Julie
University of Ottawa - Library (2025)
AI Summary: In this study, the OriGene Alix (Pdcd6ip) protein (catalog number TP303735) was used to investigate CARM1’s protein interactions, helping to identify Alix as the most prominent interactor in CARM1’s interactome.
Snippet: purified as above), GST-HuD (purified as above), Histones (Sigma, H9250), GST-OGT (1-400aa) (Proteintech, Ag2160), OGT (606-1022aa) (MyBioSource, MBS1123899), RPS7 (MyBioSource, MBS204398), Alix (Pdcd6ip) (Origene, TP303735) at 37C with 50 mM of Tris-HCl pH 7.4
Alix-normalized exosomal programmed death-ligand 1 analysis in urine enables precision monitoring of urothelial cancer
Woo, Park, Kim et al
Cancer Sci (2024)
Cited by 13
AI Summary: In this study, the Alix antibody from OriGene (cat#TP303735) was used as a key reagent to normalize exosomal PD-L1 signal intensity, enabling more accurate and reliable detection of urinary exosomal PD-L1 for monitoring urothelial cancer.
Snippet: 8H;Sino Biological), CD63 (cat#11271-H08H;Sino Biological), CD81 (cat#14244-H07H;Sino Biological), Alix (cat#TP303735;Origene), and PD-L1 (cat#156-B7;R&D Systems) were loaded on 96-well plates. … After washing with 200 μL of 0.1% BSA in PBS, 50 μL/well of detection Abs (anti-CD9, HI9A, biotin-conjugated, cat#312112, BioLegend;anti-CD63, H5C6, biotin-conjugated, cat#353017, BioLegend;anti-CD81, JS-81, cat555675, BD Biosciences;anti-PD-L1, MIH1, biotin-conjugated, cat#13-5983-82, In
Alix-Normalized Exosomal Pd-L1 Analysis in Urine Enables Precision Monitoring of Urothelial Cancer
Woo, Park, Kim et al
SSRN (2023)
Snippet: For standard curves to calculate the arbitrary amount, recombinant human CD9 133 (cat#11029-H08H, Sino Biological, Beijing, China), CD63 (cat#11271-H08H, Sino 134 Biological, Beijing, China), CD81 (cat#14244-H07H, Sino Biological, Beijing, China), 135 Alix (cat#TP303735, Origene, MD, USA), and PD-L1 (cat#156-B7, R&D Systems, MN, 136 USA) was loaded on 96 well plates
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products