OriGene Logo

NPEPL1 (NM_024663) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303704
Recombinant protein of human aminopeptidase-like 1 (NPEPL1), 20 µg
Size:
20 ug 1 mg 100 ug
In Control Promo
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA337469 Rabbit Polyclonal Anti-NPEPL1 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "NPEPL1 or NM_024663"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203704 protein sequence
Red=Cloning site Green=Tags(s)

MANVGLQFQASAGDSDPQSRPLLLLGQLHHLHRVPWSHVRGKLQPRVTEELWQAALSTLNPNPTDSCPLY
LNYATVAALPCRVSRHNSPSAAHFITRLVRTCLPPGAHRCIVMVCEQPEVFASACALARAFPLFTHRSGA
SRRLEKKTVTVEFFLVGQDNGPVEVSTLQCLANATDGVRLAARIVDTPCNEMNTDTFLEEINKVGKELGI
IPTIIRDEELKTRGFGGIYGVGKAALHPPALAVLSHTPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGM
KRDCGGAAAVLGAFRAAIKQGFKDNLHAVFCLAENSVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLA
DGVSYACKDLGADIILDMATLTGAQGIATGKYHAAVLTNSAEWEAACVKAGRKCGDLVHPLVYCPELHFS
EFTSAVADMKNSVADRDNSPSSCAGLFIASHIGFDWPGVWVHLDIAAPVHAGERATGFGVALLLALFGRA
SEDPLLNLVSPLGCEVDVEEGDLGRDSKRRRLV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 55.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_078939
Locus ID 79716
UniProt ID Q8NDH3
Cytogenetics 20q13.32
RefSeq Size 2217
RefSeq ORF 1569
Synonyms bA261P9.2
Summary Probably catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.UniProtKB/Swiss-Prot Function
Protein Categories Enzyme: Peptidases, Intracellular Proteins
Protein Families Druggable Genome, Protease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "NPEPL1" proteins (3)
SKU Description Size Price
PH303704 NPEPL1 MS Standard C13 and N15-labeled recombinant protein (NP_078939) 10 ug
$3,360.00
LC411179 NPEPL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411179 Transient overexpression lysate of aminopeptidase-like 1 (NPEPL1) 100 ug
$436.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.