OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PDE6D (NM_002601) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303172
Recombinant protein of human phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA366371 PDE6D rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PDE6D or NM_002601"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203172 protein sequence
Red=Cloning site Green=Tags(s)

MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQ
MEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLV
STSRVRLFYV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 17.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002592
Locus ID 5147
UniProt ID O43924
Cytogenetics 2q37.1
RefSeq Size 1214
RefSeq ORF 450
Synonyms JBTS22; PDED
Summary This gene encodes the delta subunit of rod-specific photoreceptor phosphodiesterase (PDE), a key enzyme in the phototransduction cascade. A similar protein in cow functions in solubilizing membrane-bound PDE. In addition to its role in the PDE complex, the encoded protein is thought to bind to prenyl groups of proteins to target them to subcellular organelles called cilia. Mutations in this gene are associated with Joubert syndrome-22. Alternative splicing results in multiple splice variants. provided by RefSeq, Mar 2014
Protein Categories Intracellular Proteins
Protein Pathways Progesterone-mediated oocyte maturation, Purine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PDE6D" proteins (5)
SKU Description Size Price
PH303172 PDE6D MS Standard C13 and N15-labeled recombinant protein (NP_002592) 10 ug
$3,360.00
LC419219 Lyophilized PDE6D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419219 Transient overexpression lysate of phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D) (as WB positive control) 100 ug
$436.00
TP760649 Purified recombinant protein of Human phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00
TP761964 Purified recombinant protein of Human phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D),full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

Identification of PDE6D as a molecular target of anecortave acetate via a methotrexate-anchored yeast three-hybrid screen
Shepard, Conrow, Pang et al
ACS Chem. Biol. (2013) 8 (3), 549-58 DOI: 10.1021/cb300296m
Cited by 15
AI Summary: In this study, OriGene’s His-tagged DHFR protein was used in coimmunoprecipitation experiments to confirm the binding interaction between anecortave acetate derivatives and their molecular target, PDE6D.
Snippet: Incubation in the presence of A1-Mtx revealed a band corresponding to the size of the His-tagged DHFR ( 20 kD), which could be competed off in elutions incubated with excess AdesA (500 μM) (Figure 5). His-DHFR detected in the elution fractions of AdesA competed with A1
SPR IP
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products