OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PI3 (NM_002638) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303136
Recombinant protein of human peptidase inhibitor 3, skin-derived (PI3), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA356507 PI3 Antibody - N-terminal region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PI3 or NM_002638"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203136 protein sequence
Red=Cloning site Green=Tags(s)

MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVS
TKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 9.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002629
Locus ID 5266
UniProt ID P19957
Cytogenetics 20q13.12
RefSeq Size 579
RefSeq ORF 351
Synonyms cementoin; ESI; SKALP; WAP3; WFDC14
Summary This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria, and fungal pathogens. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines. provided by RefSeq, Oct 2014
Protein Categories Cytokines, Secreated Proteins
Protein Families Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PI3" proteins (4)
SKU Description Size Price
PH303136 PI3 MS Standard C13 and N15-labeled recombinant protein (NP_002629) 10 ug
$3,360.00
LC400936 Lyophilized PI3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400936 Transient overexpression lysate of peptidase inhibitor 3, skin-derived (PI3) (as WB positive control) 100 ug
$436.00
TP720751 Purified recombinant protein of Human peptidase inhibitor 3, skin-derived (PI3) 10 ug
$340.00

file-alt Citations

High Serum Elafin Prediction of Poor Prognosis of Locoregional Esophageal Squamous Cell Carcinoma
Wu, Wang, Chen et al
Cancers (Basel) (2021) 13 (12) DOI: 10.3390/cancers13123082
Cited by 1
AI Summary: OriGene products, specifically the human PI3 (elafin) shRNA plasmids, were used in this study to knock down elafin expression in ESCC cell lines, enabling the researchers to demonstrate that reduced elafin levels suppressed cancer cell proliferation, migration, and invasion in vitro.
FigureFigureFigure
High Serum Elafin Prediction of Poor Prognosis of Locoregional Esophageal Squamous Cell Carcinoma
Wu, Wang, Chen et al
Cancers (2021) 13 (12), 3082 DOI: 10.3390/cancers13123082
Cited by 1
AI Summary: OriGene’s recombinant elafin protein (Cat. TP303136) was used in this study to investigate the effects of elafin on esophageal squamous cell carcinoma cell proliferation, migration, and invasion in vitro.
Snippet: rElafin was purchased from OriGene Technologies, Inc. (Cat. TP303136, Rockville, MD, USA)
FigureFigureFigure
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products