OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NUDT3 (NM_006703) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP302900
Purified recombinant protein of Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 3 (NUDT3), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA332026 Rabbit Polyclonal Anti-NUDT3 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "NUDT3 or NM_006703"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202900 representing NM_006703
Red=Cloning site Green=Tags(s)

MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEE
AGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYF
ETLRQGYSANNGTPVVATTYSVSAQSSMSGIR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 19.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006694
Locus ID 11165
UniProt ID O95989
Cytogenetics 6p21.31
RefSeq Size 1371
RefSeq ORF 516
Synonyms DIPP; DIPP-1; DIPP1
Summary NUDT3 belongs to the MutT, or Nudix, protein family. Nudix proteins act as homeostatic checkpoints at important stages in nucleoside phosphate metabolic pathways, guarding against elevated levels of potentially dangerous intermediates, like 8-oxo-dGTP, which promotes AT-to-CG transversions (Safrany et al., 1998 PubMed 9822604).supplied by OMIM, Feb 2011
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NUDT3" proteins (1)
SKU Description Size Price
PH302900 NUDT3 MS Standard C13 and N15-labeled recombinant protein (NP_006694) 10 ug
$3,360.00

file-alt Citations

Polyphosphate degradation by Nudt3-Zn2+ mediates oxidative stress response
Samper-Martín, Sarrias, Lázaro et al
Cell Rep (2021) 37 (7), 110004 DOI: 10.1016/j.celrep.2021.110004
Cited by 76
AI Summary: OriGene’s C-Myc/DDK-Nudt3 (Ref: TP302900) was used in this study to manipulate Nudt3 protein levels, enabling the authors to investigate Nudt3’s role as a polyphosphate phosphatase and its impact on oxidative stress response in mammalian cells.
Snippet: C-Myc/DDK-Nudt3 Origene Ref: TP302900
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products