OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FGL1 (NM_201553) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP302778
Purified recombinant protein of Homo sapiens fibrinogen-like 1 (FGL1), transcript variant 4, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA349318 Rabbit Polyclonal Anti-FGL1 Antibody
100 ul
$205.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "FGL1 or NM_201553"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202778 protein sequence
Red=Cloning site Green=Tags(s)

MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENT
VIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDY
ENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGT
AGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTD
NGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 34 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_963847
Locus ID 2267
UniProt ID Q08830
Cytogenetics 8p22
RefSeq Size 1500
RefSeq ORF 936
Synonyms HFREP1; HP-041; HPS; LFIRE-1; LFIRE1
Summary Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins. However, this protein lacks the platelet-binding site, cross-linking region and a thrombin-sensitive site which are necessary for fibrin clot formation. This protein may play a role in the development of hepatocellular carcinomas. Four alternatively spliced transcript variants encoding the same protein exist for this gene. provided by RefSeq, Jul 2008
Protein Categories Secreated Proteins
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FGL1" proteins (13)
SKU Description Size Price
PH302778 FGL1 MS Standard C13 and N15-labeled recombinant protein (NP_963847) 10 ug
$3,360.00
PH312499 FGL1 MS Standard C13 and N15-labeled recombinant protein (NP_004458) 10 ug
$3,360.00
LC404456 Lyophilized FGL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404457 Lyophilized FGL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407794 Lyophilized FGL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417967 Lyophilized FGL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430179 Lyophilized FGL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404456 Transient overexpression lysate of fibrinogen-like 1 (FGL1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY404457 Transient overexpression lysate of fibrinogen-like 1 (FGL1), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY407794 Transient overexpression lysate of fibrinogen-like 1 (FGL1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY417967 Transient overexpression lysate of fibrinogen-like 1 (FGL1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY430179 Transient overexpression lysate of fibrinogen-like 1 (FGL1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP312499 Recombinant protein of human fibrinogen-like 1 (FGL1), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products