OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NUDT2 (NM_147172) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP302439
Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 2 (NUDT2), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA365274 NUDT2 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "NUDT2 or NM_147172"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202439 protein sequence
Red=Cloning site Green=Tags(s)

MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQL
TIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQ
FLCSIEA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 16.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_671701
Locus ID 318
UniProt ID P50583
Cytogenetics 9p13.3
RefSeq Size 1020
RefSeq ORF 441
Synonyms APAH1
Summary This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and four transcript variants, all encoding the same protein, have been identified. provided by RefSeq, Sep 2011
Protein Categories Intracellular Proteins
Protein Pathways Purine metabolism, Pyrimidine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NUDT2" proteins (9)
SKU Description Size Price
PH302439 NUDT2 MS Standard C13 and N15-labeled recombinant protein (NP_671701) 10 ug
$3,360.00
PH319598 NUDT2 MS Standard C13 and N15-labeled recombinant protein (NP_671702) 10 ug
$3,360.00
LC403446 Lyophilized NUDT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407737 Lyophilized NUDT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420095 Lyophilized NUDT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403446 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 2 (NUDT2), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY407737 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 2 (NUDT2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY420095 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 2 (NUDT2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP319598 Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 2 (NUDT2), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products