OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BLOC1S2 (NM_001001342) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP302351
Recombinant protein of human biogenesis of lysosomal organelles complex-1, subunit 2 (BLOC1S2), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "BLOC1S2 or NM_001001342"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202351 protein sequence
Red=Cloning site Green=Tags(s)

MFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEE
QVAALEQAAYKLDAYSKKLEAKYKKLEKR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 11.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001001342
Locus ID 282991
UniProt ID Q6QNY1
Cytogenetics 10q24.31
RefSeq Size 2722
RefSeq ORF 297
Synonyms BLOS2; BORCS2; CEAP; CEAP11
Summary This gene encodes a protein with multiple functions. The encoded protein has been found in association with the centrosome, shown to co-localize with gamma-tubulin, and also found to be one of the proteins in the BLOC-1 complex which functions in the formation of lysosome-related organelles. A pseudogene of this gene is located on the X chromosome. Alternative splicing results in multiple transcript variants. provided by RefSeq, Feb 2012
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BLOC1S2" proteins (3)
SKU Description Size Price
PH302351 BLOC1S2 MS Standard C13 and N15-labeled recombinant protein (NP_001001342) 10 ug
$3,360.00
LC424327 Lyophilized BLOC1S2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY424327 Transient overexpression lysate of biogenesis of lysosomal organelles complex-1, subunit 2 (BLOC1S2), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products