OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GHDC (NM_032484) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP302272
Recombinant protein of human GH3 domain containing (GHDC), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA372616 GHDC rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "GHDC or NM_032484"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202272 protein sequence
Red=Cloning site Green=Tags(s)

MLLWPLLLLLLLLPTLALLRQQRSQDARLSWLAGLQHRVAWGALVWAATWQRRRLEQSTLHVHQSQQQAL
RWCLQGAQRPHCSLRRSTDISTFRNHLPLTKASQTQQEDSGEQPLPPTSNQDLGEASLQATLLGLAALNK
AYPEVLAQGRTARVTLTSPWPRPLPWPGNTLGQVGTPGTKDPRALLLDALRSPGLRALEAGTAVELLDVF
LGLETDGEELAGAIAAGNPGAPLRERAAELREALEQGPRGLALRLWPKLQVVVTLDAGGQAEAVAALGAL
WCQGLAFFSPAYAASGGVLGLNLQPEQPHGLYLLPPGAPFIELLPVKEGTQEEAASTLLLAEAQQGKEYE
LVLTDRASLTRCRLGDVVRVVGAYNQCPVVRFICRLDQTLSVRGEDIGEDLFSEALGRAVGQWAGAKLLD
HGCVESSILDSSAGSAPHYEVFVALRGLRNLSEENRDKLDHCLQEASPRYKSLRFWGSVGPARVHLVGQG
AFRALRAALAACPSSPFPPAMPRVLRHRHLAQCLQERVVS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 57.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_115873
Locus ID 84514
UniProt ID Q8N2G8
Cytogenetics 17q21.2
RefSeq Size 2496
RefSeq ORF 1590
Synonyms D11LGP1; LGP1
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GHDC" proteins (5)
SKU Description Size Price
PH302272 GHDC MS Standard C13 and N15-labeled recombinant protein (NP_115873) 10 ug
$3,360.00
LC410111 Lyophilized GHDC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428217 Lyophilized GHDC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410111 Transient overexpression lysate of GH3 domain containing (GHDC), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428217 Transient overexpression lysate of GH3 domain containing (GHDC), transcript variant 3 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products