OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EZH2 (NM_004456) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP302054M
Recombinant protein of human enhancer of zeste homolog 2 (Drosophila) (EZH2), transcript variant 1, 100 µg
Size:
100 ug 20 ug 1 mg
  $2,950.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA803011 EZH2 mouse monoclonal antibody, clone OTI10B10 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "EZH2 or NM_004456"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202054 protein sequence
Red=Cloning site Green=Tags(s)

MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHI
LTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLD
QDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDK
ESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHS
FHTLFCRRCFKYDCFLHRKCNYSFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKT
PPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQ
TPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDV
DTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQN
RFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWG
IFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNC
YAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 85.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity EMSA assay (PMID: 26173710)
Binding assay (AlphaScreen) (PMID: 26173710)
In vitro ubiquitination assay substrate (PMID: 27869166)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004447
Locus ID 2146
UniProt ID Q15910
Cytogenetics 7q36.1
RefSeq Size 2723
RefSeq ORF 2253
Synonyms ENX-1; ENX1; EZH2b; KMT6; KMT6A; WVS; WVS2
Summary This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Multiple alternatively splcied transcript variants encoding distinct isoforms have been identified for this gene. provided by RefSeq, Feb 2011
Protein Categories Cancer: Haematopoietic and Lymphoid, Cytokines, Intracellular Proteins
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Thyroid hormone suppresses medulloblastoma progression through promoting terminal differentiation of tumor cells
Yang, Valdés-Rives, Liu et al
Cancer Cell (2024) 42 (8), 1434-1449.e5 DOI: 10.1016/j.ccell.2024.07.008
Cited by 20
AI Summary: OriGene’s EZH2 Human Recombinant Protein (Cat# TP302054) was used in this study to investigate the molecular mechanisms by which thyroid hormone influences medulloblastoma cell differentiation and tumor progression.
Snippet: 27 supplement Thermo Fisher Cat# 17504044 EZH2 Human Recombinant Protein Origene Technologies Inc Cat# TP302054
TGFβ1-RCN3-TGFBR1 loop facilitates pulmonary fibrosis by orchestrating fibroblast activation
Wu, Wang, Shi et al
Respir Res (2023) 24 (1), 222 DOI: 10.1186/s12931-023-02533-z
Cited by 25
AI Summary: In this study, OriGene's recombinant human EZH2 protein (TP302054) was used in biolayer interferometry assays to investigate and confirm the direct interaction between RCN3 and EZH2, elucidating a key mechanism in fibroblast activation and pulmonary fibrosis.
Snippet: yer interferometry (BLI) Rcn3–EZH2 direct interaction determined by biolayer interferometry technology by OctetRED system (ForteBio) using human recombinant proteins (hrRcn3: Abcam, ab276552;EZH2: Origene, TP302054), following manufacturer’s protocol. In brief, rhEZH2 was biotinylated by Biotinylation Kit (Thermo Scientific, 21329) followed by desalting using desalt columns (thermos scientifi
FigureFigureFigure
Yin Yang 1-Induced Long Noncoding RNA DUXAP9 Drives the Progression of Oral Squamous Cell Carcinoma by Blocking CDK1-Mediated EZH2 Degradation
Zhou, Feng, Lin et al
Adv Sci (Weinh) (2023)
Cited by 38
AI Summary: OriGene’s human recombinant EZH2 protein (#TP302054) was used in an in vitro reconstituted RIP assay to investigate the interaction between EZH2 and the lncRNA DUXAP9 in this study on oral squamous cell carcinoma progression.
Snippet: An in vitro reconstituted RIP assay was conducted with human recombinant EZH2 protein (#TP302054, Origene, US) and DUXAP9 transcribed by a T7 High Yield RNA Transcription Kit (Beyotime, China). The primers used for PCR are listed in Table S4 (Supporting Information)
A PRC2-independent function for EZH2 in regulating rRNA 2'-O methylation and IRES-dependent translation
Yi, Li, Meng et al
Nat Cell Biol (2021) 23 (4), 341-354 DOI: 10.1038/s41556-021-00653-6
Cited by 109
AI Summary: OriGene contributed to this study by providing all the tagged and untagged recombinant proteins used in the protein displacement and binding assays, as detailed in Supplementary Table 5.
Snippet: Then, a third protein or an untagged version of one or the other proteins was introduced to the displacement assay to affect the existing association between beads. The alpha signals reflecting the binding affinity were measured in a Tecan plate reader in AlphaLISA detection mode. All the tagged or untagged recombinant proteins used in this assay were ordered from OriGene and the corresponding don...
SKP2 loss destabilizes EZH2 by promoting TRAF6-mediated ubiquitination to suppress prostate cancer
Lu, Liu, Li et al
Oncogene (2016)
AI Summary: In this study, recombinant Flag-EZH2 from OriGene was used in in vitro ubiquitination assays to investigate the role of TRAF6-mediated ubiquitination in the regulation and degradation of EZH2 in prostate cancer cells.
Snippet: In vitro ubiquitination reaction consisted of the following components: ~1 g purifiedGST-TRAF6 or its mutant C70A, 2 g recombinant Flag-EZH2 (Origene, Rockville, MD, USA),100 M HA-ubiquitin, 100 nM E1, 1 M of Ubc13/UeV1a (Boston Biochem, Cambridge, ... Cite SaveSaving
Screening for Small-Molecule Modulators of Long Noncoding RNA-Protein Interactions Using AlphaScreen
Pedram Fatemi, Salah-Uddin, Modarresi et al
J Biomol Screen (2015)
Cited by 103
AI Summary: OriGene contributed to this study by providing purified human EZH2 protein (cat No. TP302054), which was essential for analyzing lncRNA-protein interactions using the AlphaScreen assay.
Snippet: No. 20158) as per the manufacturer's instructions using the 3′ end biotinylated RNA (1 nM). Purified human EZH2 protein (C-terminal Flag/myc tag) was obtained from Origene technologies (Rockville, MD, cat No. TP302054). ... Cite SaveSaving
Showing 1-6 of 7 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products