PIM2 (NM_006875) Human Recombinant Protein

CAT#: TP301933L

Recombinant protein of human pim-2 oncogene (PIM2), 1 mg

Product Images

Coomassie blue staining of purified PIM2 protein (Cat# TP301933). The protein was produced from HEK293T cells transfected with PIM2 cDNA clone (Cat# RC201933) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201933 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAIKVIPRNRVLG
  WSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPLPAQDLFDYITEKGPLGEGPS
  RCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWIS
  RHQYHALPATVWSLGILLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEI
  LLDPWMQTPAEDVPLNPSKGGPAPLAWSLLP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006866
• Locus ID: 11040
• UniProt ID: Q9P1W9, A0A024QYW7
• Cytogenetics: Xp11.23
• Refseq Size: 2234
• Refseq ORF: 933
• Summary: This gene encodes a protooncogene that acts as a serine/threonine protein kinase. Studies determined the encoded protein functions to prevent apoptosis and to promote cell survival.[provided by RefSeq, Nov 2009]
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Acute myeloid leukemia