HEBP1 (NM_015987) Human Recombinant Protein
CAT#: TP301873
Recombinant protein of human heme binding protein 1 (HEBP1), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201873 protein sequence
Red=Cloning site Green=Tags(s) MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTN DKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAK EADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057071 |
Locus ID | 50865 |
UniProt ID | Q9NRV9, A0A024RAS8 |
Cytogenetics | 12p13.1 |
Refseq Size | 1221 |
Refseq ORF | 567 |
Synonyms | HBP; HEBP |
Summary | The full-length protein encoded by this gene is an intracellular tetrapyrrole-binding protein. This protein includes a natural chemoattractant peptide of 21 amino acids at the N-terminus, which is a natural ligand for formyl peptide receptor-like receptor 2 (FPRL2) and promotes calcium mobilization and chemotaxis in monocytes and dendritic cells. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402480 | HEBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402480 | Transient overexpression lysate of heme binding protein 1 (HEBP1) |
USD 436.00 |
|
PH301873 | HEBP1 MS Standard C13 and N15-labeled recombinant protein (NP_057071) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review