OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RRNAD1 (NM_015997) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301870
Recombinant protein of human chromosome 1 open reading frame 66 (C1orf66), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "RRNAD1 or NM_015997"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201870 protein sequence
Red=Cloning site Green=Tags(s)

MPGISARGLSHEGRKQLAVNLTRVLALYRSILDAYIIEFFTDNLWDTLPCSWQEALDGLKPPQLATMLLG
MPGEGEVVRYRSVWPLTLLALKSTACALAFTRMPGFQTPSEFLENPSQSSRLTAPFRKHVRPKKQHEIRR
LGELVKKLSDFTGCTQVVDVGSGQGHLSRFMALGLGLMVKSIEGDQRLVERAQRLDQELLQALEKEEKRN
PQVVQTSPRHSPHHVVRWVDPTALCEELLLPLENPCQGRARLLLTGLHACGDLSVALLRHFSCCPEVVAL
ASVGCCYMKLSDPGGYPLSQWVAGLPGYELPYRLREGACHALEEYAERLQKAGPGLRTHCYRAALETVIR
RARPELRRPGVQGIPRVHELKIEEYVQRGLQRVGLDPQLPLNLAALQAHLAQENRVVAFFSLALLLAPLV
ETLILLDRLLYLQEQLFHAELLPIFSPELSPRNLVLVATKMPLGQALSVLETEDS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 52.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057081
Locus ID 51093
UniProt ID Q96FB5
Cytogenetics 1q23.1
RefSeq Size 2283
RefSeq ORF 1425
Synonyms C1orf66; CGI-41; METTL25B
Protein Categories Intracellular Proteins, Membrane Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RRNAD1" proteins (5)
SKU Description Size Price
PH301870 C1orf66 MS Standard C13 and N15-labeled recombinant protein (NP_057081) 10 ug
$3,360.00
LC414258 Lyophilized RRNAD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428176 Lyophilized RRNAD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414258 Transient overexpression lysate of chromosome 1 open reading frame 66 (C1orf66), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428176 Transient overexpression lysate of chromosome 1 open reading frame 66 (C1orf66), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products