OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ERAB (HSD17B10) (NM_004493) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301734
Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 10 (HSD17B10), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA500686 Anti-HSD17B10 mouse monoclonal antibody, clone OTI10B4 (formerly 10B4) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "ERAB or NM_004493"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201734 protein sequence
Red=Cloning site Green=Tags(s)

MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKD
VQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNE
PDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLP
EKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 25.8 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004484
Locus ID 3028
UniProt ID Q99714
Cytogenetics Xp11.22
RefSeq Size 963
RefSeq ORF 783
Synonyms 17b-HSD10; ABAD; CAMR; DUPXp11.22; ERAB; HADH2; HCD2; HSD10MD; MHBD; MRPP2; MRX17; MRX31; MRXS10; SCHAD; SDR5C1
Summary This gene encodes 3-hydroxyacyl-CoA dehydrogenase type II, a member of the short-chain dehydrogenase/reductase superfamily. The gene product is a mitochondrial protein that catalyzes the oxidation of a wide variety of fatty acids and steroids, and is a subunit of mitochondrial ribonuclease P, which is involved in tRNA maturation. The protein has been implicated in the development of Alzheimer disease, and mutations in the gene are the cause of 17beta-hydroxysteroid dehydrogenase type 10 (HSD10) deficiency. Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined. provided by RefSeq, Aug 2014
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways Alzheimer's disease, leucine and isoleucine degradation, Metabolic pathways, Valine
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ERAB" proteins (5)
SKU Description Size Price
PH301734 HSD17B10 MS Standard C13 and N15-labeled recombinant protein (NP_004484) 10 ug
$3,360.00
LC401426 Lyophilized HSD17B10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421990 Lyophilized HSD17B10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401426 Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 10 (HSD17B10), nuclear gene encoding mitochondrial protein, transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421990 Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 10 (HSD17B10), nuclear gene encoding mitochondrial protein, transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

Metabolomics and In Silico Docking-Directed Discovery of Small-Molecule Enzyme Targets
Xu, Zhao, Wang et al
Anal Chem (2021) 93 (6), 3072-3081 DOI: 10.1021/acs.analchem.0c03684
Cited by 35
AI Summary: OriGene contributed to this study by providing human recombinant HADH and HSD17B10 proteins, which were used to experimentally confirm enzyme binding with the small molecule triphenyl phosphate.
Snippet: The human recombinant proteins of HADH andHSD17B10 were purchased from OriGene Technologies Inc
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products