CIRBP (NM_001280) Human Recombinant Protein

CAT#: TP301639

Reviews ()
Write a review

Recombinant protein of human cold inducible RNA binding protein (CIRBP), transcript variant 1

Size: 20 ug 100 ug 1 mg



  View other "CIRBP" proteins (3)

USD 867.00

In Stock*

Size
    • 20 ug

Product images

Frequently bought together (2)
Rabbit Polyclonal Anti-CIRBP Antibody
    • 100 ul

USD 539.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 412.00

Other products for "CIRBP"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC201639 protein sequence
Red=Cloning site Green=Tags(s)

MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGK
SVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRD
YYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 18.5 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001271
Locus ID 1153
UniProt ID Q14011, Q53XX5
Cytogenetics 19p13.3
Refseq Size 1397
Refseq ORF 516
Synonyms CIRP
Summary Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3' UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor (By similarity). Promotes assembly of stress granules (SGs), when overexpressed.[UniProtKB/Swiss-Prot Function]

Documents

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.