NPDC1 (NM_015392) Human Recombinant Protein

CAT#: TP301415M

Recombinant protein of human neural proliferation, differentiation and control, 1 (NPDC1), 100 µg

Product Images

Coomassie blue staining of purified NPDC1 protein (Cat# TP301415). The protein was produced from HEK293T cells transfected with NPDC1 cDNA clone (Cat# RC201415) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201415 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPF
  QEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGL
  ELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDGLALVLILAFCVAGAAALSVASLCWCRLQ
  REIRLTQKADYATAKAPGSPAAPRISPGDQRLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTASSDEEN
  EDGDFTVYECPGLAPTGEMEVRNPLFDHAALSAPLPAPSSPPALP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056207
• Locus ID: 56654
• UniProt ID: Q9NQX5
• Cytogenetics: 9q34.3
• Refseq Size: 1548
• Refseq ORF: 975
• Synonyms: CAB; CAB-; CAB-1; CAB1; NPDC-1
• Summary: Suppresses oncogenic transformation in neural and non-neural cells and down-regulates neural cell proliferation. Might be involved in transcriptional regulation (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane