PP2A-alpha (PPP2CA) (NM_002715) Human Recombinant Protein

CAT#: TP301334

Recombinant protein of human protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (PPP2CA), 20 µg

Product Images

Coomassie blue staining of purified PPP2CA protein (Cat# TP301334). The protein was produced from HEK293T cells transfected with PPP2CA cDNA clone (Cat# RC201334) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201334 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFR
  IGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNA
  NVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWG
  ISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDD
  TLKYSFLQFDPAPRRGEPHVTRRTPDYFL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002706
• Locus ID: 5515
• UniProt ID: P67775, B3KUN1
• Cytogenetics: 5q31.1
• Refseq Size: 2643
• Refseq ORF: 927
• Synonyms: NEDLBA; PP2Ac; PP2CA; PP2Calpha; RP-C
• Summary: This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Phosphatase, Transcription Factors
• Protein Pathways: Long-term depression, Oocyte meiosis, TGF-beta signaling pathway, Tight junction, Wnt signaling pathway