OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VTI1B (NM_006370) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301172
Recombinant protein of human vesicle transport through interaction with t-SNAREs homolog 1B (yeast) (VTI1B), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "VTI1B or NM_006370"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201172 protein sequence
Red=Cloning site Green=Tags(s)

MASSAASSEHFEKLHEIFRGLHEDLQGVPERLLGTAGTEEKKKLIRDFDEKQQEANETLAEMEEELRYAP
LSFRNPMMSKLRNYRKDLAKLHREVRSTPLTATPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLN
RATQSIERSHRIATETDQIGSEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTNKLLLS
IIILLELAILGGLVYYKFFRSH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 26.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006361
Locus ID 10490
UniProt ID Q9UEU0
Cytogenetics 14q24.1
RefSeq Size 1357
RefSeq ORF 696
Synonyms v-SNARE; VTI1; VTI1-LIKE; vti1-rp1; VTI1L; VTI2
Summary V-SNARE that mediates vesicle transport pathways through interactions with t-SNAREs on the target membrane. These interactions are proposed to mediate aspects of the specificity of vesicle trafficking and to promote fusion of the lipid bilayers. May be concerned with increased secretion of cytokines associated with cellular senescence.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Druggable Genome, Transmembrane
Protein Pathways SNARE interactions in vesicular transport
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VTI1B" proteins (3)
SKU Description Size Price
PH301172 VTI1B MS Standard C13 and N15-labeled recombinant protein (NP_006361) 10 ug
$3,360.00
LC416689 Lyophilized VTI1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416689 Transient overexpression lysate of vesicle transport through interaction with t-SNAREs homolog 1B (yeast) (VTI1B) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products