OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MTMR14 (NM_022485) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300809M
Recombinant protein of human myotubularin related protein 14 (MTMR14), transcript variant 3, 100 µg
Size:
100 ug 20 ug 1 mg
  $2,508.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "MTMR14 or NM_022485"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200809 protein sequence
Red=Cloning site Green=Tags(s)

MAGARAAAAAASAGSSASSGNQPPQELGLGELLEEFSRTQYRAKDGSGTGGSKVERIEKRCLELFGRDYC
FSVIPNTNGDICGHYPRHIVFLEYESSEKEKDTFESTVQVSKLQDLIHRSKMARCRGRFVCPVILFKGKH
ICRSATLAGWGELYGRSGYNYFFSGGADDAWADVEDVTEEDCALRSGDTHLFDKVRGYDIKLLRYLSVKY
ICDLMVENKKVKFGMNVTSSEKVDKAQRYADFTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAP
LSIPDFLTHSLNIDWSQYQCWDLVQQTQNYLKLLLSLVNSDDDSGLLVHCISGWDRTPLFISLLRLSLWA
DGLIHTSLKPTEILYLTVAYDWFLFGHMLVDRLSKGEEIFFFCFNFLKHITSEEFSALKTQRRKSLPARD
GGFTLEDICMLRRKDRGSTTSLGSDFSLVMESSPGATGSFTYEAVELVPAGAPTQAAWLAALSDRETRLQ
EVRSAFLAAYSSTVGLRAVAPSPSGAIGGLLEQFARGVGLRSISSNAL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 59.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Enzyme activity (PMID: 26312549)
Enzyme activity (PMID: 28205624)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_071930
Locus ID 64419
UniProt ID Q8NCE2
Cytogenetics 3p25.3
RefSeq Size 2200
RefSeq ORF 1614
Synonyms C3orf29
Summary This gene encodes a myotubularin-related protein. The encoded protein is a phosphoinositide phosphatase that specifically dephosphorylates phosphatidylinositol 3,5-biphosphate and phosphatidylinositol 3-phosphate. Mutations in this gene are correlated with autosomal dominant centronuclear myopathy. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 18.provided by RefSeq, Apr 2010
Protein Categories Intracellular Proteins
Protein Families Druggable Genome, Phosphatase, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

The small molecule AUTEN-99 (autophagy enhancer-99) prevents the progression of neurodegenerative symptoms
Kovács, Billes, Komlós et al
Sci Rep (2017) 7, 42014 DOI: 10.1038/srep42014
AI Summary: OriGene’s purified MTMR14/Jumpy protein (catalog #TP300809) was used in biochemical assays to evaluate the inhibitory effects of AUTEN-99 on MTMR14 activity in this study.
Snippet: MTMR14/Jumpy protein was purchased from OriGene Technologies (Rockville, USA). The biochemical assay consisted of purified MTMR14 (OriGene Technologies, TP300809) (37 ng/reaction), 100 μM phosphatidylinositol 3-phosphate (Echelon Biosciences, P-3008) in 25 mM Tris (pH = 6) buffer (Molar Chemicals, 09350-101-190) containing 2 mM DTT (Sigma, 17-1318-01) in 10 μl total volume
FigureFigureFigure
AUTEN-67, an autophagy-enhancing drug candidate with potent antiaging and neuroprotective effects
Papp, Kovács, Billes et al
Autophagy (2015)
Cited by 63
AI Summary: OriGene’s purified MTMR14 protein (catalog #TP300809) was used in biochemical assays to evaluate the inhibitory effects of AUTEN-67 on MTMR14 activity in this study.
Snippet: MTMR14 assay: MTMR14 protein was purchased from OriGene Technologies (022485). The biochemical assay consisted of purified MTMR14 protein (OriGene Technologies, TP300809) (37 ng/reaction), 100 µM phosphatidylinositol 3-phosphate (Echelon Biosciences, P-3008a) in 25 mM Tris-HCl, pH 6 buffer (Molar Chemicals, 09350-101-190) containing 2 mM DTT (Sigma, 17-1318-01) in 10-µl total volume
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products