OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SOX2 (NM_003106) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300757L
Recombinant protein of human SRY (sex determining region Y)-box 2 (SOX2), 1 mg
Size:
1 mg 20 ug 100 ug
  $7,820.00
6 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA591006 Rabbit monoclonal anti-Sox2 Antibody, clone OTIR-2D11
100 ul
$519.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SOX2 or NM_003106"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200757 protein sequence
Red=Cloning site Green=Tags(s)

MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSE
ISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMA
SGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSM
TSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPG
AEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 34.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity EMSA assay (PMID: 25892221)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003097
Locus ID 6657
UniProt ID P48431
Cytogenetics 3q26.33
RefSeq Size 2520
RefSeq ORF 951
Synonyms ANOP3; MCOPS3
Summary This intronless gene encodes a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The product of this gene is required for stem-cell maintenance in the central nervous system, and also regulates gene expression in the stomach. Mutations in this gene have been associated with optic nerve hypoplasia and with syndromic microphthalmia, a severe form of structural eye malformation. This gene lies within an intron of another gene called SOX2 overlapping transcript (SOX2OT). provided by RefSeq, Jul 2008
Protein Categories Growth Factors, Intracellular Proteins, Transciption Factors
Protein Families Adult stem cells, Cancer stem cells, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Structural Constraints of Nucleosomes on Transcription-Factor Binding
Wilson
Thesis (2026)
AI Summary: OriGene products contributed full-length human transcription factors KLF4 (TP306691), OCT4 (TP311998), SOX2 (TP300757), and MYC (TP301611) for protein-nucleosome binding assays in the study.
Snippet: The protein-nucleosome binding assays were carried out by incubating the purified nucleosome libraries described above and human full-length KLF4 (Origene TP306691), OCT4 (Origene TP311998), SOX2 (Origene TP300757), and MYC (Origene TP301611) with MAX
Defining transcription factor nucleosome binding with Pioneer-seq
Tsompana, Wilson, Murugaiyan et al
PLoS Genet (2025) 21 (8), e1011813 DOI: 10.1371/journal.pgen.1011813
Cited by 6
Snippet: or up to 1 month. DNA binding assay followed by EMSA The protein-nucleosome binding assays were carried out by incubating the purified nucleosome libraries described above and human full-length KLF4 (Origene TP306691), OCT4 (Origene TP311998), SOX2 (Origene TP300757), and MYC (Origene TP301611) with MAX (Origene TP306812) (in 7 µl DNA binding buffer (10 mM Tris-Cl [pH7.5], 50 mM NaCl, 1 mM
FigureFigureFigure
Pioneer transcription factors target partial DNA motifs on nucleosomes to initiate reprogramming
Soufi, Garcia, Jaroszewicz et al
Cell (2015) 161 (3), 555-68 DOI: 10.1016/j.cell.2015.03.017
Cited by 855
AI Summary: OriGene contributed mammalian-expressed recombinant human Oct4 (TP311998), Sox2 (TP300757), Klf4 (TP306691), and c-Myc (TP301611) proteins that were used to study how pioneer transcription factors target nucleosomal DNA motifs during cellular reprogramming.
Snippet: Protein Expression and Purification We made the bacterial expression plasmids pET-28B-huOct4, pET-28B-huSox2, pET-28B-huKlf4, and pET-28B-huMyc encoding the full-length human O, S, K, M, respectively, fused to an N-terminal 6× histidine tag. The recombinant proteins were expressed in E. coli Rosetta (DE3) pLysS (Novagen #70956-3) and purified using a nickel charged column under denaturing conditions The mammalian expressed human OSKM recombinant proteins were obtained from OriGene (Oct4 #TP311998, Sox2 #TP300757, Klf4 #TP306691, c-Myc #TP301611). …
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products