OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PCLAF (NM_014736) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300694
Recombinant protein of human KIAA0101 (KIAA0101), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA366344 PCLAF rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PCLAF or NM_014736"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200694 protein sequence
Red=Cloning site Green=Tags(s)

MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFR
LSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 11.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_055551
Locus ID 9768
UniProt ID Q15004
Cytogenetics 15q22.31
RefSeq Size 1515
RefSeq ORF 333
Synonyms KIAA0101; L5; NS5ATP9; OEATC; OEATC-1; OEATC1; p15(PAF); p15/PAF; p15PAF; PAF; PAF15
Summary PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PCLAF" proteins (4)
SKU Description Size Price
PH300694 KIAA0101 MS Standard C13 and N15-labeled recombinant protein (NP_055551) 10 ug
$3,360.00
LC415072 Lyophilized KIAA0101 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415072 Transient overexpression lysate of KIAA0101 (KIAA0101), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP761509 Purified recombinant protein of Human KIAA0101 (KIAA0101), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products