OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MAGEA8 (NM_005364) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300670
Recombinant protein of human melanoma antigen family A, 8 (MAGEA8), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA369200 MAGEA8 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "MAGEA8 or NM_005364"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200670 protein sequence
Red=Cloning site Green=Tags(s)

MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASS
SLTVTDSTLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLE
SVIKNYKNHFPDIFSKASECMQVIFGIDVKEVDPAGHSYILVTCLGLSYDGLLGDDQSTPKTGLLIIVLG
MILMEGSRAPEEAIWEALSVMGLYDGREHSVYWKLRKLLTQEWVQENYLEYRQAPGSDPVRYEFLWGPRA
LAETSYVKVLEHVVRVNARVRISYPSLHEEALGEEKGV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005355
Locus ID 4107
UniProt ID P43361
Cytogenetics Xq28
RefSeq Size 1860
RefSeq ORF 954
Synonyms CT1.8; MAGE8
Summary This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Multiple alternatively spliced variants, encoding the same protein, have been identified. provided by RefSeq, Oct 2009
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MAGEA8" proteins (5)
SKU Description Size Price
PH300670 MAGEA8 MS Standard C13 and N15-labeled recombinant protein (NP_005355) 10 ug
$3,360.00
LC401650 Lyophilized MAGEA8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432878 Lyophilized MAGEA8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401650 Transient overexpression lysate of melanoma antigen family A, 8 (MAGEA8), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY432878 Transient overexpression lysate of melanoma antigen family A, 8 (MAGEA8), transcript variant 1 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products