ID3 (NM_002167) Human Recombinant Protein

CAT#: TP300583

Recombinant protein of human inhibitor of DNA binding 3, dominant negative helix-loop-helix protein (ID3), 20 µg

Product Images

Coomassie blue staining of purified ID3 protein (Cat# TP300583). The protein was produced from HEK293T cells transfected with ID3 cDNA clone (Cat# RC200583) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200583 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEIL
  QRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002158
• Locus ID: 3399
• UniProt ID: Q02535
• Cytogenetics: 1p36.12
• Refseq Size: 1252
• Refseq ORF: 357
• Synonyms: bHLHb25; HEIR-1
• Summary: The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it interacts. [provided by RefSeq, Aug 2011]
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
• Protein Pathways: TGF-beta signaling pathway