OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PLGF (PGF) (NM_002632) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300443
Purified recombinant protein of Human placental growth factor (PGF), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA328423 Anti-Human PlGF-1 Rabbit Polyclonal Antibody
100 ug
$340.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PLGF or NM_002632"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200443 representing NM_002632
Red=Cloning site Green=Tags(s)

MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVE
HMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPE
RRRPKGRGKRRREKQRPTDCHLCGDAVPRR

myc-FLAG tag
Tag Myc-DDK
Predicted MW 19.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002623
Locus ID 5228
UniProt ID P49763
Cytogenetics 14q24.3
RefSeq Size 1758
RefSeq ORF 510
Synonyms D12S1900; PGFL; PIGF; PLGF; PlGF-2; SHGC-10760
Summary This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.provided by RefSeq, Jun 2011
Protein Categories Growth Factors, Secreated Proteins
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Bladder cancer, Focal adhesion, mTOR signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PLGF" proteins (5)
SKU Description Size Price
LC419203 Lyophilized PGF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419203 Transient overexpression lysate of placental growth factor (PGF) (as WB positive control) 100 ug
$436.00
TP333309 Purified recombinant protein of Homo sapiens placental growth factor (PGF), transcript variant 2, full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 µg 20 ug
$867.00
TP723864 Purified recombinant protein of Human placental growth factor (PGF / PLGF-1), transcript variant 1 10 ug
$315.00
TP762420 Purified recombinant protein of Human placental growth factor (PGF), transcript variant 1, Leu19-Arg131, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products