OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FCGRT (NM_004107) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300364
Recombinant protein of human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "FCGRT or NM_004107"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200364 representing NM_004107
Red=Cloning site Green=Tags(s)

MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEP
CGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEF
MNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKAR
PSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHA
GLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEA
QDADLKDVNVIPATA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 39.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity MS digestion standard (PMID: 27012525)
MS digestion standard (PMID: 27232760)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004098
Locus ID 2217
UniProt ID P55899
Cytogenetics 19q13.33
RefSeq Size 1510
RefSeq ORF 1095
Synonyms alpha-chain; FCRN
Summary This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants. provided by RefSeq, Apr 2009
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FCGRT" proteins (8)
SKU Description Size Price
PH300364 FCGRT MS Standard C13 and N15-labeled recombinant protein (NP_004098) 10 ug
$3,360.00
PH327329 FCGRT MS Standard C13 and N15-labeled recombinant protein (NP_001129491) 10 ug
$3,360.00
LC401327 Lyophilized FCGRT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427768 Lyophilized FCGRT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401327 Transient overexpression lysate of Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427768 Transient overexpression lysate of Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP327329 Recombinant protein of human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2, 20 µg 20 ug
$737.00
TP721216 Purified recombinant protein of Human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2 10 ug
$275.00

file-alt Citations

Utility of a human FcRn transgenic mouse model in drug discovery for early assessment and prediction of human pharmacokinetics of monoclonal antibodies
Avery, Wang, Kavosi et al
MAbs (2016) 8 (6), 1064-78 DOI: 10.1080/19420862.2016.1193660
AI Summary: OriGene’s recombinant full-length human FcRn protein was used to prepare calibration standards for tissue analysis, enabling accurate measurement of hFcRn expression in the transgenic mouse model studied.
Snippet: Calibration standards were prepared by adding recombinant full-length human FcRn protein (OriGene) into control mouse liver lysate prepared from BALB/C mice (+mFcRn, -hFcRn) that served as calibration matrices for all tissues
Quantitative analysis of human neonatal Fc receptor (FcRn) tissue expression in transgenic mice by online peptide immuno-affinity LC-HRMS
Fan, Neubert
Anal. Chem. (2016)
Cited by 38
AI Summary: OriGene's recombinant full-length hFcRn protein (TP300364) was used as a spike-in standard to enable accurate quantification of human FcRn expression in mouse tissue lysates in this study.
Snippet: matrix. Recombinant full-length hFcRn protein (TP300364, OriGene Rockville, MD), whose concentration was pre- determined using SIL peptides and MS analysis, was spiked into control mouse liver lysate prior to acetone precipitation. ... Cite SaveSaving
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products