DUSP23 (NM_017823) Human Recombinant Protein

CAT#: TP300171M

Recombinant protein of human dual specificity phosphatase 23 (DUSP23), 100 µg

Product Images

Coomassie blue staining of purified DUSP23 protein (Cat# TP300171). The protein was produced from HEK293T cells transfected with DUSP23 cDNA clone (Cat# RC200171) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200171 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPA
  PDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEK
  AVFQFYQRTK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060293
• Locus ID: 54935
• UniProt ID: Q9BVJ7, A0A140VJI5
• Cytogenetics: 1q23.2
• Refseq Size: 718
• Refseq ORF: 450
• Synonyms: DUSP25; LDP-3; LDP3; MOSP; VHZ
• Summary: Protein phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. In vitro, it can dephosphorylate p44-ERK1 (MAPK3) but not p54 SAPK-beta (MAPK10) in vitro. Able to enhance activation of JNK and p38 (MAPK14).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Phosphatase