ZNF581 (NM_016535) Human Recombinant Protein

CAT#: TP300091

Recombinant protein of human zinc finger protein 581 (ZNF581), 20 µg

Product Images

Coomassie blue staining of purified ZNF581 protein (Cat# TP300091). The protein was produced from HEK293T cells transfected with ZNF581 cDNA clone (Cat# RC200091) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200091 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQGVPYTVLVDEE
  SQREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDICGKAFKRASHLARHHSIHLAG
  GGRPHGCPLCPRRFRDAGELAQHSRVHSGERPFQCPHCPRRFMEQNTLQKHTRWKHP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057619
• Locus ID: 51545
• UniProt ID: Q9P0T4
• Cytogenetics: 19q13.42
• Refseq Size: 1258
• Refseq ORF: 591
• Synonyms: HSPC189
• Summary: May be involved in transcriptional regulation.[UniProtKB/Swiss-Prot Function]