OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FGF1 (NM_001144934) Human Mass Spec Standard

Be the first to review this product
SKU
PH327790
FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_001138406)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY400278 Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "FGF1 or NM_001144934"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC227790
Predicted MW 17.5 kDa
Protein Sequence
Protein Sequence
>RC227790 protein sequence
Red=Cloning site Green=Tags(s)

MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVY
IKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHY
GQKAILFLPLPVSSD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138406
RefSeq Size 3875
RefSeq ORF 465
Synonyms AFGF; ECGF; ECGF-beta; ECGFA; ECGFB; FGF-1; FGF-alpha; FGFA; GLIO703; HBGF-1; HBGF1
Locus ID 2246
UniProt ID P05230
Cytogenetics 5q31.3
Summary The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. provided by RefSeq, Jan 2009
Protein Families Druggable Genome, Secreted Protein
Protein Pathways MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FGF1" proteins (18)
SKU Description Size Price
PH307434 FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_000791) 10 ug
$3,360.00
PH327317 FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_001138364) 10 ug
$3,360.00
PH327797 FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_001138407) 10 ug
$3,360.00
LC400278 Lyophilized FGF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428552 Lyophilized FGF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428587 Lyophilized FGF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428588 Lyophilized FGF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400278 Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428552 Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY428587 Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY428588 Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 6 (as WB positive control) 100 ug
$436.00
TP307434 Recombinant protein of human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1, 20 µg 20 ug
$867.00
TP327317 Purified recombinant protein of Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 4, 20 µg 20 ug
$867.00
TP327790 Purified recombinant protein of Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 5, 20 µg 20 ug
$867.00
TP327797 Purified recombinant protein of Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 6, 20 µg 20 ug
$867.00
TP720040 Recombinant protein of human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1 10 ug
$190.00
TP721185 Purified recombinant protein of Human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1 10 ug
$275.00
TP750001 Recombinant protein of human Fibroblast Growth Factor-acidic (FGF1) produced in E. coli 100 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products