FGF1 (NM_001144935) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC227797] |
Predicted MW | 17.5 kDa |
Protein Sequence |
Protein Sequence
>RC227797 protein sequence
Red=Cloning site Green=Tags(s) MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVY IKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHY GQKAILFLPLPVSSD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001138407 |
RefSeq Size | 3781 |
RefSeq ORF | 465 |
Synonyms | AFGF; ECGF; ECGF-beta; ECGFA; ECGFB; FGF-1; FGF-alpha; FGFA; GLIO703; HBGF-1; HBGF1 |
Locus ID | 2246 |
UniProt ID | P05230 |
Cytogenetics | 5q31.3 |
Summary | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq, Jan 2009] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH307434 | FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_000791) | 10 ug |
$3,255.00
|
|
PH327317 | FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_001138364) | 10 ug |
$3,255.00
|
|
PH327790 | FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_001138406) | 10 ug |
$3,255.00
|
|
LC400278 | FGF1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428552 | FGF1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428587 | FGF1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428588 | FGF1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400278 | Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1 | 100 ug |
$436.00
|
|
LY428552 | Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 4 | 100 ug |
$436.00
|
|
LY428587 | Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 5 | 100 ug |
$436.00
|
|
LY428588 | Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 6 | 100 ug |
$436.00
|
|
TP307434 | Recombinant protein of human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
TP327317 | Purified recombinant protein of Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 4, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP327790 | Purified recombinant protein of Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 5, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP327797 | Purified recombinant protein of Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 6, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP720040 | Recombinant protein of human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1 | 10 ug |
$185.00
|
|
TP721185 | Purified recombinant protein of Human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1 | 10 ug |
$265.00
|
|
TP750001 | Recombinant protein of human Fibroblast Growth Factor-acidic (FGF1) produced in E. coli | 100 ug |
$515.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.