FGF1 (NM_001144934) Human Mass Spec Standard

SKU
PH327790
FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_001138406)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227790]
Predicted MW 17.5 kDa
Protein Sequence
Protein Sequence
>RC227790 protein sequence
Red=Cloning site Green=Tags(s)

MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVY
IKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHY
GQKAILFLPLPVSSD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138406
RefSeq Size 3875
RefSeq ORF 465
Synonyms AFGF; ECGF; ECGF-beta; ECGFA; ECGFB; FGF-1; FGF-alpha; FGFA; GLIO703; HBGF-1; HBGF1
Locus ID 2246
UniProt ID P05230
Cytogenetics 5q31.3
Summary The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq, Jan 2009]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton
Write Your Own Review
You're reviewing:FGF1 (NM_001144934) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH307434 FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_000791) 10 ug
$3,255.00
PH327317 FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_001138364) 10 ug
$3,255.00
PH327797 FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_001138407) 10 ug
$3,255.00
LC400278 FGF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428552 FGF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428587 FGF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428588 FGF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400278 Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1 100 ug
$436.00
LY428552 Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 4 100 ug
$436.00
LY428587 Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 5 100 ug
$436.00
LY428588 Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 6 100 ug
$436.00
TP307434 Recombinant protein of human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1, 20 µg 20 ug
$867.00
TP327317 Purified recombinant protein of Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP327790 Purified recombinant protein of Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 5, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP327797 Purified recombinant protein of Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 6, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720040 Recombinant protein of human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1 10 ug
$185.00
TP721185 Purified recombinant protein of Human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1 10 ug
$265.00
TP750001 Recombinant protein of human Fibroblast Growth Factor-acidic (FGF1) produced in E. coli 100 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.